Total number of results for Capra hircus are 10
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00826 |
ACNTATCMTHRLAGWLSRSGSMVRSNLLPTKMGFKIFSGPRKNFWF
|
46 | Capra hircus | Calcitonin | Calcitonin receptor-stimulating peptide 1 | ||
| NP00827 |
SCNRATCVTHKMAGSLSRSGSEIKRNFMSTNVGSKAFGQRSRDLQK
|
46 | Capra hircus | Calcitonin | Calcitonin receptor-stimulating peptide 2 | ||
| NP02276 |
YADAIFTNSYRKILGQLSARKLLQDIMNRQQERNQEQGAKVRL
|
43 | Capra hircus | Glucagon | Growth hormone-releasing factor | 6440561#Brazeau P, Böhlen P, Esch F, Ling N, Wehrenberg WB, Guillemin R#Growth hormone-releasing factor from ovine and caprine hypothalamus: isolation, sequence analysis and total synthesis#Biochem Biophys Res Commun 1984 Dec 14;125(2):606-14 | |
| NP02305 |
YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL
|
44 | Capra hircus | Glucagon | Somatoliberin | 6440561#Brazeau P., Boehlen P., Esch F., Ling N., Wehrenberg W.B., Guillemin R.#Growth hormone-releasing factor from ovine and caprine hypothalamus: isolation, sequence analysis and total synthesis.# Biochem. Biophys. Res. Commun. 125:606-614(1984). | |
| NP02306 |
HSDAVFTDNYTRLRKQMAVKKYLNSILN
|
28 | Capra hircus | Glucagon | Vasoactive intestinal peptide | 3748846#Eng J., Du B.-H., Raufman J.-P., Yalow R.S.#Purification and amino acid sequences of dog, goat and guinea pig VIPs.# Peptides 7 Suppl. 1:17-20(1986). | |
| NP02630 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
|
70 | Capra hircus | Insulin | Insulin-like growth factor I | ||
| NP02631 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Capra hircus | Insulin | Insulin B chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
| NP02632 |
GIVEQCCAGVCSLYQLENYCN
|
21 | Capra hircus | Insulin | Insulin A chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
| NP02856 |
VPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPGC
|
146 | Capra hircus | Leptin | Leptin | ||
| NP05431 |
TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGYITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMILGQVIPGAKETEPYPVWSGLPSLQTKDEEARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
|
199 | Capra hircus | Somatotropin/prolactin | Prolactin |